IL-17AF: Mouse Interleukin-17AF Heterodimer | sputnic-group.ru : Cell Applications

+7(499)397-01-09 Корзина

Каталог > Клеточные линии, штаммы, среды > Клеточная биология > Факторы роста и Цитокины >
IL-17AF: Mouse Interleukin-17AF Heterodimer

BACKGROUND Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells.

Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It is comprised of one monomeric subunit each of IL-17A and IL-17F, having a total of 271 amino acids and an molecular weight of 30.7 kDa.

Products are for research use only. They are not intended for human, animal, or diagnostic applications.

Параметры

Cat. No.:

RP2061

Alternative Name:

None

Source:

E. coli

Physical Appearance:

Sterile Filtered white lyophilized (freeze-dried) powder.

Formulation:

Recombinant mouse IL-17AF is lyophilized with no additives.

Stability:

Lyophilized product is very stable at -20°C. Reconstituted material should be aliquoted and frozen at -20°C. It is recommended that a carrier protein (0.1% HSA or BSA) is added for long term storage.

Reconstitution:

Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/ml, which can be further diluted into other aqueous solutions.

Protein Content and Purity determined by:

UV spectroscopy at 280 nm.
RP-HPLC calibrated against a known standard.
Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels.

Endotoxin Level:

Endotoxin level, as measured by LAL analysis, is <0.01ng/ug or <0.1EU/ug.

Biological Activity:

The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is 75-325 ng/ml.

AA Sequence:

IL-17A: MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPW TLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFT FRVEKMLVGVGCTCVASIVRQAA
IL-17F: MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNR SSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRRE PQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Документы

Product Sheet RP2061

IL-17AF

Название	Код	Цена
Mouse Interleukin-17AF Heterodimer	RP2061-1000	по запросу
Mouse Interleukin-17AF Heterodimer	RP2061-25	по запросу
Mouse Interleukin-17AF Heterodimer	RP2061-100	по запросу

Факторы роста и Цитокины

Информация представлена исключительно в ознакомительных целях и ни при каких условиях не является публичной офертой